PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G25340.1
Common NameAtMYB116, MYB116
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 283aa    MW: 32691.7 Da    PI: 6.2577
Description myb domain protein 116
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G25340.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-142067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd ll +++   G g+W++ a+  g++R +k+c++rw++yl
      AT1G25340.1 20 KGPWTLEEDTLLTNYISHNGEGRWNLLAKSSGLKRAGKSCRLRWLNYL 67
                     79******************************99************97 PP

2Myb_DNA-binding51.13e-1673116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++ ++G++ W++I+++++ gRt++++k++w++
      AT1G25340.1  73 RGNLTPQEQLLILELHSKWGNR-WSKISKYLP-GRTDNDIKNYWRT 116
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.1161567IPR017930Myb domain
SuperFamilySSF466893.0E-2918114IPR009057Homeodomain-like
SMARTSM007172.0E-111969IPR001005SANT/Myb domain
PfamPF002494.4E-132067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-212174IPR009057Homeodomain-like
CDDcd001678.70E-82267No hitNo description
PROSITE profilePS5129425.47968122IPR017930Myb domain
SMARTSM007176.4E-1572120IPR001005SANT/Myb domain
PfamPF002492.4E-1573116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2275121IPR009057Homeodomain-like
CDDcd001676.83E-1177116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000036anatomyleaf vascular system
PO:0000282anatomytrichome
PO:0000293anatomyguard cell
PO:0003011anatomyroot vascular system
PO:0004707anatomyfruit dehiscence zone
PO:0006504anatomyleaf trichome
PO:0009001anatomyfruit
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MSNITKKKCN GNEEGAEQRK GPWTLEEDTL LTNYISHNGE GRWNLLAKSS GLKRAGKSCR  60
LRWLNYLKPD IKRGNLTPQE QLLILELHSK WGNRWSKISK YLPGRTDNDI KNYWRTRVQK  120
QARQLNIDSN SHKFIEVVRS FWFPRLINEI KDNSYTNNIK ANAPDLLGPI LRDSKDLGFN  180
NMDCSTSMSE DLKKTSQFMD FSDLETTMSL EGSRGGSSQC VSEVYSSFPC LEEEYMVAVM  240
GSSDISALHD CHVADSKYED DVTQDLMWNM DDIWQFNEYA HFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-25201227108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible245643_at0.0
Expression AtlasAT1G25340-
AtGenExpressAT1G25340-
ATTED-IIAT1G25340-
Functional Description ? help Back to Top
Source Description
TAIRputative transcription factor (MYB116)
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00159DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G25340.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G25340
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3348150.0AF334815.2 Arabidopsis thaliana putative transcription factor (MYB116) mRNA, complete cds.
GenBankAY5195580.0AY519558.1 Arabidopsis thaliana MYB transcription factor (At1g25340) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564230.10.0putative transcription factor (MYB116)
TrEMBLQ94FU00.0Q94FU0_ARATH; MYB transcription factor
STRINGAT1G25340.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26322571
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]